Purchase Qty.: (Pieces) |
10-100 101-300 301-600 601+ |
---|---|
Reference FOB Unit Price: | US $45.00 US $44.70 US $44.40 US $44.00 |
Inventory: | Spot Goods |
---|---|
Delivery Time: | 3-6 Days |
Purity: | >99% |
Use: | Anti-Aging |
Transport Package: | Box |
Specification: | 5mg |
Specification
Product Name | Fox04-Dri |
CAS NO | CAS 2460055-10-9 |
Function | Fox04-Dri is an advanced robotic companion designed to provide intelligent assistance and companionship to individuals in various settings. With its sleek design and cutting-edge technology, Fox04-Dri offers a wide range of features and functionalities that enhance the user's everyday life. Equipped with state-of-the-art artificial intelligence, Fox04-Dri can understand and respond to natural language commands and engage in meaningful conversations. Its advanced language processing capabilities enable it to provide information, answer questions, and assist with various tasks, making it an invaluable personal assistant. |
Apparence | White Powder |
Package | Aluminum Bag;Drums;Paper Box Outside |
Product Description
Product Description
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
Function & Application
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
Already occupying 30% share of Melanotan-II tanning peptide in China's export market, we have passed ISO; Halal; Kosher; FDA; SGS and many other certifications for the record.
In the future, MOL Changes' vision is to become a global leading company in individual bioactive peptide products, and to establish a strong product matrix in the peptide field to help our customers take the leading position in the market.
Package
Pack the box in a cardboard box when shipping.
Transportation & Delivery
·Small batches are sent by DHL and fedex, and the shipping time is 3-6 days to your hands.
·A large number of products are sent by air, the transportation time is 12-18 days, including tax to the door.
Certification & Registration
ISO9001
FDA registration
SGS
HALAL
KOF-L