Inventory: | Spot Goods |
---|---|
Delivery Time: | 3-6 Days |
Purity: | >99% |
Use: | Anti-Aging |
Transport Package: | Box |
Specification: | 5mg |
Samples: |
---|
Suppliers with verified business licenses
Product Name | Fox04-Dri |
CAS NO | CAS 2460055-10-9 |
Function |
Fox04-Dri is an advanced robotic companion designed to provide intelligent assistance and companionship to individuals in various settings. With its sleek design and cutting-edge technology, Fox04-Dri offers a wide range of features and functionalities that enhance the user's everyday life. Equipped with state-of-the-art artificial intelligence, Fox04-Dri can understand and respond to natural language commands and engage in meaningful conversations. Its advanced language processing capabilities enable it to provide information, answer questions, and assist with various tasks, making it an invaluable personal assistant. |
Apparence | White Powder |
Package | Aluminum Bag;Drums;Paper Box Outside |
Product description
Product Description
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
Function & Application
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
Suppliers with verified business licenses