Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso

Product Details
Inventory: Spot Goods
Delivery Time: 3-6 Days
Purity: >99%
Still deciding? Get samples of US$ 45/Piece
Request Sample
Gold Member Since 2023

Suppliers with verified business licenses

Audited Supplier

Audited by an independent third-party inspection agency

  • Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
  • Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
  • Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
  • Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
  • Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
  • Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
Find Similar Products

Basic Info.

Model NO.
fox04-dri-08
Use
Anti-Aging
Transport Package
Box
Specification
5mg
Trademark
MOL Changes
Origin
China
Production Capacity
80000

Product Description


Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
Specification

Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso 
Product Name Fox04-Dri 
CAS NO CAS 2460055-10-9
Function

Fox04-Dri is an advanced robotic companion designed to provide intelligent assistance and companionship to individuals in various settings. With its sleek design and cutting-edge technology, Fox04-Dri offers a wide range of features and functionalities that enhance the user's everyday life.

Equipped with state-of-the-art artificial intelligence, Fox04-Dri can understand and respond to natural language commands and engage in meaningful conversations. Its advanced language processing capabilities enable it to provide information, answer questions, and assist with various tasks, making it an invaluable personal assistant.

Apparence White Powder
Package Aluminum Bag;Drums;Paper Box Outside

Product Description
Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso

Product Description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

Function & Application

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.


 

About Us
Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
MOL Changes is based on bioactive peptide R&D and production, providing high end peptide molecule biologics for pharmaceutical and cosmetic companies.

Already occupying 30% share of Melanotan-II tanning peptide in China's export market, we have passed ISO;  Halal;  Kosher;  FDA;  SGS and many other certifications for the record.

In the future, MOL Changes' vision is to become a global leading company in individual bioactive peptide products, and to establish a strong product matrix in the peptide field to help our customers take the leading position in the market.
 
Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
The research and development team from Lilly and novonordisk Biopeptide research and development team has published 19 research results of life active peptides applied in the field of medical beauty in China.
 
Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
The production lines meet the requirements of GMP management and realize the data monitoring of the whole process.
 
Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
Relying on automated assembly line, it provides small-batch active biological peptide products for most medical and beauty institutions and laboratory pharmaceutical enterprises.

Package
 
Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
All products come in a box of 10 bottles.
Pack the box in a cardboard box when shipping.

Transportation & Delivery
 
Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
All products are delivered by express and airmail

·Small batches are sent by DHL and fedex, and the shipping time is 3-6 days to your hands.
·A large number of products are sent by air, the transportation time is 12-18 days, including tax to the door.


Certification & Registration 
Manufactor Supply Top Quality Raw Injection Fox04-Dri Foxo4-Dri Powder Peptide Foxo4-D-Retro-Inverso
Has passed a number of certifications

ISO9001

FDA registration

SGS

HALAL

KOF-L

 



 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Contact Supplier